@plotly/react-msa-viewer

A React component to create Multiple Sequence Alignments

Please use react-msa-viewer
Last updated 2 years ago by wilzbach .
MIT · Repository · Bugs · Original npm · Tarball · package.json
$ cnpm install @plotly/react-msa-viewer 
SYNC missed versions from official npm registry.

<MSAViewer />

Travis NPM codecov

react-msa-viewer is a performant, extendable, highly-customizable, production-ready React Component that renders a Multiple Sequence Alignment (MSA).

WARNING: Work in progress - use with caution

Live demo

MSAViewer example

Checkout the storybook at https://msa.bio.sh

Getting started

import MSAViewer from '@plotly/react-msa-viewer';

function MSA() {
  const options = {
    sequences: [
      {
        name: "seq.1",
        sequence: "MEEPQSDPSIEP-PLSQETFSDLWKLLPENNVLSPLPS-QA-VDDLMLSPDDLAQWLTED"
      },
      {
        name: "seq.2",
        sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
      },
      {
        name: "seq.3",
        sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
      },
    ],
    colorScheme: "zappo",
  };
  return (
    <MSAViewer {...options} />
  );
}

Open on CodePen

Installation

For npm users, run:

npm i --save @plotly/react-msa-viewer

For yarn users, run:

yarn add @plotly/react-msa-viewer

Use your own layout

<MSAViewer> acts a Context Provider for all MSA subcomponents. Hence, it will automatically take care of synchronization between all MSA components in its tree:

import {
  Labels,
  MSAViewer,
  OverviewBar,
  PositionBar,
  SequenceOverview,
  SequenceViewer,
} from '@plotly/react-msa-viewer';

function MSA() {
  const options = {
    sequences: [
      {
        name: "seq.1",
        sequence: "MEEPQSDPSIEP-PLSQETFSDLWKLLPENNVLSPLPS-QA-VDDLMLSPDDLAQWLTED"
      },
      {
        name: "seq.2",
        sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
      },
      {
        name: "seq.3",
        sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
      },
    ],
  };
  return (
    <MSAViewer {...options}>
      <SequenceOverview method="information-content"/>
      <div style={{display: "flex"}} >
        <div>
          <SequenceViewer/>
          <br/>
          <OverviewBar/>
          <PositionBar/>
        </div>
        <Labels/>
      </div>
    </MSAViewer>
  );
}

Open on CodePen

Usage in Vanilla JS

Using the react-msa-viewer with React is highly recommended. However, it can be used in Vanilla JS:

<html>
<meta charset="utf-8" />
<script src="https://cdnjs.cloudflare.com/ajax/libs/react/15.4.2/react.min.js"></script>
<script src="https://cdnjs.cloudflare.com/ajax/libs/react-dom/15.4.2/react-dom.min.js"></script>
<script src="https://cdnjs.cloudflare.com/ajax/libs/prop-types/15.5.2/prop-types.js"></script>
<script src="https://unpkg.com/@plotly/react-msa-viewer/dist/index.umd.min.js"></script>
<body>
  <div id="my-msa" />
  <script>
  var options = {
    sequences: [
      {
        name: "seq.1",
        sequence: "MEEPQSDPSIEP-PLSQETFSDLWKLLPENNVLSPLPS-QA-VDDLMLSPDDLAQWLTED"
      },
      {
        name: "seq.2",
        sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
      },
      {
        name: "seq.3",
        sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
      },
    ],
    colorScheme: "zappo",
   };
  ReactDOM.render(
    React.createElement(ReactMSAViewer.MSAViewer, options),
    document.getElementById('my-msa')
  );
  </script>
</body>
</html>

See an example on CodePen.

Props

Warning: these properties are still susceptible to a change at any moment.

MSAViewer (component)

A general-purpose layout for the MSA components

When children are passed it acts as a Context Provider for the msaStore, otherwise it provides a default layout and forwards it props the respective components.

TBD

Labels (component)

Displays the sequence names.

Props

cacheElements

defaultValue: 10

font

Font of the sequence labels, e.g. 20px Arial

type: string

labelAttributes

Attributes to apply to each label.

type: object

labelComponent

Component to create labels from.

type: union(object|func)

labelStyle

Inline styles to apply to each label.

type: object defaultValue: {}

style

Inline styles to apply to the Label component

type: object

OverviewBar (component)

Creates a small overview box of the sequences for a general overview.

Props

engine

Rendering engine: canvas or webgl (experimental).

type: enum('canvas'|'webgl') defaultValue: "canvas"

fillColor

Fill color of the OverviewBar, e.g. #999999

type: string defaultValue: "#999999"

height (required)

Width of the component (in pixels), e.g. 100

type: number defaultValue: 50

method

Method to use for the OverviewBar:

  • information-content: Information entropy after Shannon of a column (scaled)
  • conservation: Conservation of a column (scaled)

type: enum('information-content'|'conservation') defaultValue: "conservation"

style

Custom style configuration.

type: object

width (required)

Width of the component (in pixels), e.g. 100

type: number

PositionBar (component)

Displays the sequence names with an arbitrary Marker component

Props

cacheElements

defaultValue: 10

font

Font of the sequence labels, e.g. 20px Arial

type: string

height

Height of the PositionBar (in pixels), e.g. 100

type: number defaultValue: 15

markerAttributes

Attributes to apply to each marker.

type: object

markerComponent

Component to create markers from.

type: union(object|func)

markerSteps

At which steps the position labels should appear, e.g. 2 for (1, 3, 5)

type: number defaultValue: 2

markerStyle

Inline styles to apply to each marker.

type: object defaultValue: {}

startIndex

At which number the PositionBar marker should start counting. Typical values are: 1 (1-based indexing) and 0 (0-based indexing).

type: number defaultValue: 1

style

Inline styles to apply to the PositionBar component

type: object defaultValue: { font: "12px Arial", }

SequenceOverview (component)

Props

engine

Rendering engine: canvas or webgl (experimental).

type: enum('canvas'|'webgl') defaultValue: "canvas"

height (required)

Width of the component (in pixels), e.g. 100

type: number defaultValue: 50

style

Custom style configuration.

type: object

tileHeight

Height of a tile in the OverviewBar, e.g. 5

type: number defaultValue: 5

tileWidth

Width of a tile in the OverviewBar, e.g. 5

type: number defaultValue: 5

width (required)

Width of the component (in pixels), e.g. 100

type: number

SequenceViewer (component)

Component to draw the main sequence alignment.

Props

border

Whether to draw a border.

type: bool defaultValue: false

borderColor

Color of the border. Name, hex or RGB value.

type: string defaultValue: "black"

borderWidth

Width of the border.

type: number defaultValue: 1

cacheElements

Number of residues to prerender outside of the visible viewbox.

type: number defaultValue: 20

onResidueClick

Callback fired when the mouse pointer clicked a residue.

type: func

onResidueDoubleClick

Callback fired when the mouse pointer clicked a residue.

type: func

onResidueMouseEnter

Callback fired when the mouse pointer is entering a residue.

type: func

onResidueMouseLeave

Callback fired when the mouse pointer is leaving a residue.

type: func

overflow

What should happen if content overflows.

type: enum("hidden"|"auto"|"scroll") defaultValue: "hidden"

overflowX

What should happen if x-axis content overflows (overwrites "overflow")

type: enum("hidden"|"auto"|"scroll"|"initial") defaultValue: "auto"

overflowY

What should happen if y-axis content overflows (overwrites "overflow")

type: enum("hidden"|"auto"|"scroll"|"initial") defaultValue: "auto"

scrollBarPositionX

X Position of the scroll bar ("top or "bottom")

type: enum("top"|"bottom") defaultValue: "bottom"

scrollBarPositionY

Y Position of the scroll bar ("left" or "right")

type: enum("left"|"right") defaultValue: "right"

showModBar

Show the custom ModBar

type: bool defaultValue: false

textColor

Color of the text residue letters (name, hex or RGB value)

type: string defaultValue: "black"

textFont

Font to use when drawing the individual residues.

type: string defaultValue: "18px Arial"

xGridSize

Number of residues to cluster in one tile (x-axis) (default: 10)

type: number defaultValue: 10

yGridSize

Number of residues to cluster in one tile (y-axis) (default: 10)

type: number defaultValue: 10

Creating your own MSA components

The React MSA Viewer uses an Redux store internally. You can connect your components with it too.

import React, {Component} from 'react';
import {
  msaConnect,
  MSAViewer,
  SequenceViewer,
} from '@plotly/react-msa-viewer';

class MyFirstMSAPluginComponent extends React.Component {
  render() {
    const residue = "E";
    const style = {
      width: this.props.tileWidth,
      height: this.props.tileHeight,
      backgroundColor: this.props.colorScheme.getColor(residue),
    }
    return (
      <div style={style}>
        {residue}
      </div>
    );
  }
}

const mapStateToProps = state => {
  return {
    tileHeight: state.props.tileHeight,
    tileWidth: state.props.tileWidth,
    colorScheme: state.props.colorScheme,
  }
}

const MyFirstMSAPlugin = msaConnect(
  mapStateToProps,
)(MyFirstMSAPluginComponent);

function MyMSA() {
  return (
    <MSAViewer sequences={sequences}>
      <SequenceViewer />
      <br />
      <MyFirstMSAPlugin />
    </MSAViewer>
  );
}

Open on CodePen

However, for performance reasons you need to use a special mixin to listen for position events.

import {
  withPositionStore,
  MSAViewer,
  SequenceViewer,
} from '@plotly/react-msa-viewer';


class MyFirstMSAPlugin extends React.Component {
  shouldRerender(newPosition) {
     return true;
  }
  render() {
    return (
      <div>
        x: {this.position.xPos}, y: {this.position.yPos}
      </div>
    );
  }
}

// inject the MSAPositionStore as this.position
withPositionStore(MyFirstMSAPlugin);

function MyMSA() {
  return (
    <MSAViewer sequences={sequences}>
      <SequenceViewer />
      <MyFirstMSAPlugin />
    </MSAViewer>
  );
}

ReactDOM.render(<MyMSA />, document.getElementById("my-msa"));

Open on CodePen

Alternatively, you can also listen to events.

Listen to events

The MSAViewer components (and its subcomponents) provide a variety of callbacks like onResidueClick that can be used to plug with your code:

import {
  MSAViewer,
} from 'react-msa-viewer';

function MyMSA() {
  return <MSAViewer sequences={sequences} onResidueClick={console.log} />
}

Open on CodePen

Some events also trigger custom DOM events which might simply subscription outside of React:

<html>
<meta charset="utf-8" />
<script src="https://cdnjs.cloudflare.com/ajax/libs/react/15.4.2/react.min.js"></script>
<script src="https://cdnjs.cloudflare.com/ajax/libs/react-dom/15.4.2/react-dom.min.js"></script>
<script src="https://cdnjs.cloudflare.com/ajax/libs/prop-types/15.5.2/prop-types.js"></script>
<script src="https://unpkg.com/@plotly/react-msa-viewer/dist/index.umd.min.js"></script>
<body>
  <div id="my-msa" />
  <script>
    var options = {
      sequences: [
        {
          name: "seq.1",
          sequence: "MEEPQSDPSIEP-PLSQETFSDLWKLLPENNVLSPLPS-QA-VDDLMLSPDDLAQWLTED"
        },
        {
          name: "seq.2",
          sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
        },
        {
          name: "seq.3",
          sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
        }
      ],
      colorScheme: "zappo"
    };
    var el = document.getElementById("my-msa");
    ReactDOM.render(React.createElement(ReactMSAViewer.MSAViewer, options), el);
    el.addEventListener('residueClick', (e) => console.log(e.detail));
  </script>
</body>
</html>

Open on CodePen.

The custom DOM events bubble up the tree and contain their payload in.detail.

Sending actions

While the most common way to update the MSA is to update its properties, you can also send a variety of actions to the MSAViewer.

import {
  MSAViewer,
} from 'react-msa-viewer';

class MyMSA extends React.Component {
  moveLeft = () => {
    this.msa.movePosition({yMovement: -10})
  }
  moveRight = () => {
    this.msa.movePosition({yMovement: 10})
  }
  jumpOrigin = () => {
    debugger;
    this.msa.movePosition({yPos: 0})
  }
  render() {
    return (
      <div>
        <MSAViewer sequences={sequences} ref={(ref) => this.msa = ref} />
        <button onClick={this.moveLeft}>Move left</button>
        <button onClick={this.moveRight}>Move right</button>
        <button onClick={this.jumpOrigin}>Jump to the origin</button>
      </div>
    );
  }
}

Open on CodePen

It's also possible to use actions to create a payload and dispatch it later:

import {
  MSAViewer,
} from 'react-msa-viewer';

class MyMSA extends React.Component {
  moveLeft = () => {
    const payload = actions.movePosition({yMovement: -10});
    this.msa.dispatch(payload);
  }
  moveRight = () => {
    const payload = actions.movePosition({yMovement: 10});
    this.msa.dispatch(payload);
  }
  jumpOrigin = () => {
    const payload = actions.updatePosition({yPos: 0});
    this.msa.dispatch(payload);
  }
  render() {
    return (
      <div>
        <MSAViewer sequences={sequences} ref={(ref) => this.msa = ref} />
        <button onClick={this.moveLeft}>Move left</button>
        <button onClick={this.moveRight}>Move right</button>
        <button onClick={this.jumpOrigin}>Jump to the origin</button>
      </div>
    );
  }
}

Development

Getting started

Get the code:

git clone https://github.com/plotly/react-msa-viewer

Install the project dev dependencies:

npm install

Contributing

Please, see the CONTRIBUTING file.

Contributor Code of Conduct

Please note that this project is released with a Contributor Code of Conduct. By participating in this project you agree to abide by its terms. See CODE_OF_CONDUCT file.

License

react-msa-viewer is released under the MIT License. See the bundled LICENSE file for details.

Current Tags

  • 0.0.12                                ...           latest (2 years ago)

11 Versions

  • 0.0.12 [deprecated]           ...           2 years ago
  • 0.0.11 [deprecated]           ...           2 years ago
  • 0.0.9 [deprecated]           ...           2 years ago
  • 0.0.8 [deprecated]           ...           2 years ago
  • 0.0.7 [deprecated]           ...           2 years ago
  • 0.0.6 [deprecated]           ...           2 years ago
  • 0.0.5 [deprecated]           ...           2 years ago
  • 0.0.4 [deprecated]           ...           2 years ago
  • 0.0.3 [deprecated]           ...           2 years ago
  • 0.0.2 [deprecated]           ...           2 years ago
  • 0.0.1 [deprecated]           ...           2 years ago
Downloads
Today 0
This Week 0
This Month 0
Last Day 0
Last Week 0
Last Month 1
Dependencies (8)
Dependents (0)
None

Copyright 2014 - 2016 © taobao.org |